Swagelok fittings catalogue pdf. com the source for tube fittings, valves, and other .
Swagelok fittings catalogue pdf Swagelok® process interface valves enable a smooth transition from the process piping system to instrumentation in a single configuration, providing fewer potential leak points, lower installed weight, and a smaller space envelope. Heavy-wall fittings are available only in 316 stainless steel. Download Swagelok valve catalogs for specifications, features, ordering information, and more. Contact your authorized Swagelok sales and service representative for information about additional sizes and special alloys. Product CatalogeDTR Electronic Catalog Swagelok now offers eDTR (Electronic Desktop Technical Reference) software to help you quickly and easily find the Swagelok solution for your application. A packing adjustment may be required periodically to increase service life and to prevent leakage. This easy-to-use pocket guide was designed to give you the reference information you need in compact form on our most popular valves. S. Easy to disconnect and reconnect for reliable, low-maintenance operation. Cleaning and Packaging All integral-bonnet needle valves are cleaned and packaged in accordance with Swagelok Standard Cleaning and Packaging (SC-10) catalog, MS-06-62. It discusses the features of the two-ferrule mechanical grip design used in the fittings. Pressure ratings of valves with VCO fitting end connections are based on the ratings of the mating fitting; see the Swagelok VCO O-Ring Face Seal Fittings catalog, MS-01-28. This quarter-turn ball valve is available in 2- and 3-way confi gurations as well as a variety of materials including stainless steel, carbon steel, brass and special alloys. Each valve has a specific function—to block pressure, to bleed off pressure, or to equalize pressure—depending on its location on the manifold. Connect the machined ferrule end before connecting the tube adapter end . This is up to date at the time of printing, with its revision number shown on the back page. Introduction Swagelok® valves provide consistent, high-quality performance in a wide variety of applications. Cleaning and packaging in accordance with Swagelok Special Cleaning and Packaging (SC-11) catalog, MS-06-63, to ensure compliance with product cleanliness requirements stated in ASTM G93 Level High-Purity PFA Fine Thread Flare Fittings Swagelok® Medium- and High-Pressure Fittings and Adapters — Alloy Materials Medium- and High-Pressure Fittings, Tubing, Valves, and Accessories Flange to Tube Fittings Flange Adapters (MS-02-200) Jacketed Tube Connectors, JTC Fittings Jacketed Tube Connector, JTC Pipe Fittings Pipe Fittings Vacuum As with any mixed-material assembly, pressure ratings for tubing and fittings from different alloys will be governed by the lower material rating. 012 % (seamless) and 0. Corrosion Swagelok tube fittings are available in a variety of materials, including optimized 316 stainless steel chemistry with elevated nickel, chromium, and other elements for superior corrosion resistance in a variety of applications, including chemical processing, sour gas and subsea systems. See Swagelok Ultrahigh-Purity Process Specification (SC-01) catalog, MS-06-61; Swagelok Photovoltaic Process Specification (SC-06) catalog, MS-06-64; and Swagelok Special Cleaning and Packaging (SC-11) catalog, MS-06 -63, for details on processes, process controls, and process ver i fi ca tion. Dimensions are shown with Swagelok nuts finger-tight. For higher pressures, see the Swagelok Medium- and High-Pressure Fittings, Tubing, Valves and Accessories catalog, MS-02-472. Swagelok tube adapters are to be used ONLY in Swagelok tube fittings. For more information, see the Swagelok Ball Valve Actuation Options catalog, MS-02-343. Warning: Do not mix/interchange Swagelok products or components not governed by industrial design standards, including Swagelok tube fitting end connections, with those of other manufacturers. Both the original Swagelok 40 series and the newer 40G series valves accommodate a wide range of actuator, flow path, and handle options, as well as offer ease of packing adjustment while inline. Adapter Fittings KF to VCR® metal gasket face seal, VCO® O-ring face seal, NPT, Swagelok® tube fitting, and ultra-torr vacuum fitting Important Information About Swagelok General Service Ball Valves Swagelok general service ball valves are designed to be operated in a fully open or fully closed position. For more information, see Swagelok Standard Cleaning and Packaging (SC-10) (MS-06-62). See the Swagelok Gaugeable Tube Fittings and Adapter Fittings catalog, MS-01-140, for more information about Swagelok tube fitting features and performance. Features GU series needle valves are for use in general-purpose applications to isolate or vent system media. Safe practices and proper installation are imperative to the performance of the Swagelok tube fitting, especially in critical applications. tubing based on ASTM F1387, “Standard Specification for Performance of Piping and Tubing Mechanically Attached Fittings” and received U. Cleaning and Packaging All Swagelok R series relief valves are cleaned and packaged in accordance with Swagelok Standard Cleaning and Packaging (SC-10) (MS-06-62), page 1174 . For Swagelok nut dimensions, see the Swagelok Gaugeable Tube Fittings and Adapter Fittings catalog (MS-01-140), page 2. High-Purity PFA Fine Thread Flare Fittings Swagelok® Medium- and High-Pressure Fittings and Adapters — Alloy Materials Medium- and High-Pressure Fittings, Tubing, Valves, and Accessories Flange to Tube Fittings Flange Adapters (MS-02-200) Jacketed Tube Connectors, JTC Fittings Jacketed Tube Connector, JTC Pipe Fittings Pipe Fittings Vacuum Pipe Thread Fittings A thread sealant should always be used when assembling tapered threads . Fitting Products Swagelok offers a wide variety of tubing products. Hard copies available upon request. Once you install the software, you will have access to a comprehensive library of Swagelok product data, including catalogs, installation instructions, technical bulletins, product test reports, videos This document provides information on Swagelok gaugeable tube fittings and adapter fittings. SWAGELOK-TUBE-FITTING-CATALOG. Pressure ratings of valves with VCR® or VCO® fitting end connections are based on the ratings of the mating fitting; refer to Swagelok VCR Metal Gasket Face Seal Fittings catalog, MS-01-24, and Swagelok VCO O-Ring Face Seal Fittings catalog, MS-01-28 As with any mixed-material assembly, pressure ratings for tubing and fittings from different alloys will be governed by the lower material rating. Cleaning and Packaging All Swagelok trunnion ball valves are cleaned and packaged in accordance with Swagelok Standard Cleaning and Packaging (SC-10) catalog, MS-06-62. SWAKTM anaerobic pipe thread sealant, PTFE-Free pipe thread sealant, and Swagelok PTFE Tape are available . Minimum order quantities may apply to certain materials and configurations. The valve stem threads are isolated from the media. Search for and download CAD files and sales drawings for Swagelok parts. Function, material compatibility, adequate ratings, proper installation, operation, and maintenance are the responsibilities of the system Swagelok. Hundreds of items organized by topic. They provide leak-tight performance while minimizing galling and optimizing the number of threads of engagement by exceeding the design requirements of industry standards. For more information, see the Swagelok Leak Detectors, Lubricants, and Sealants catalog, MS-01-91. Align the gauge dial to the desired position. Permanent, high-integrity connections provide strength and reliability in a range of alloys to meet your requirements for quality and corrosion-resistance. Swagelok offers weld fittings in a variety of materials, sizes, and shapes to suit any industrial or high-purity application. Safe Product Selection The complete catalog contents must be reviewed to ensure that the system designer and user make a safe product selection. Bellows- and Diaphragm-Sealed Multiport and Elbow Valves and Monoblock Manifolds Selection Guide, ALD, BN, DF, DL/DS, DP, and HB Series Diaphragm Valves, LD Series Swagelok designs and manufactures a range of the highest quality fluid system components, including fittings, valves, regulators, gauges, hoses, and tubing. When selecting products, the total system design must be considered to ensure safe, trouble-free performance. Swagelok CW series valves are processed in accordance with Swagelok Special Cleaning and Packaging (SC-11) catalog, MS-06-63, to ensure compliance with product cleanliness requirements stated in ASTM G93 Level C. 2 Download Swagelok tubing and tube accessories catalogs for specifications, features, ordering information, and more. . Ball valves, check valves, metering valves, shutoff valves, process instrumentation valves, manifolds, more. Contact Oshwin for a complete stock list. Use in fittings made by other manufacturers may result in leakage or slippage. Swagelok tube fittings have attained leadership in industry because of outstanding design principles in combination with superior metallurgy, close manufacturing tolerances and quality assurance within each stage of the manufacturing process. For higher pressures, see the Swagelok Medium- and High-Pressure Fittings, Tubing, Valves, and Accessories catalog, MS-02-472. Ordering Numbers and Dimensions, 10 Additional Products For SAF 507 super duplex tube fittings, see the Swagelok Gaugeable SAF 2507TM Super Duplex Tube Fittings catalog, MS-01-174. The hardened stainless steel, nonrotating needle promotes leak-tight shutoff and long service life. In the following pages you will find technical and ordering information on medium and high-pressure products. About Swagelok Company Swagelok Company is an approximately $2 billion privately held developer of fluid system products, assemblies, and services for the oil and gas, chemical and petrochemical, semiconductor, and transportation industries. Our focus is on understanding our customers’ needs, finding timely solutions, and adding value with our products and services. For higher pressures, see the Swagelok Medium-Pressure Fittings catalog, MS-02-335, or the Swagelok High-Pressure Fittings catalog, MS-01-34. Messages from customers credit Swagelok components and tube fittings, along with Swagelok distributor support, as having played a major role in helping them succeed. Cleaning and Packaging, page 2, to order tube butt weld fittings cleaned in accordance with Swagelok Special Cleaning and Packaging (SC-11) catalog, MS-06-63; Photovoltaic Process Specification (SC-06) catalog, MS-06-64; or Ultrahigh-Purity Process Specification (SC-01) catalog, MS-06-61. Wherever gases and liquids flow, Swagelok®tube fittings are preferred for their robust performance, reliability and availability. Additional regional languages may be available on your local Swagelok Sales and Service Center's websites. The basic ordering numbers for these fittings include the material designator. See page 4. male pipe end connections. Swagelok® benders provide high-quality bends on fractional and metric tubing made from materials that can be used with Swagelok tube fittings. For more information about pressure ratings of valves with tube fitting end connections, see Swagelok Tubing Data, MS-01-107. Cleaning and packaging in accordance with Swagelok Special Cleaning and Packaging (SC-11) catalog, MS-06-63, to ensure compliance with product cleanliness requirements stated in ASTM G93 Level C is available. Pressure ratings of valves with VCR® or VCO® fitting end connections are based on the ratings of the mating fitting; refer to Swagelok VCR Metal Gasket Face Seal Fittings catalog, MS-01-24, and Swagelok VCO O-Ring Face Seal Fittings catalog, MS-01-28 See Swagelok Ultrahigh-Purity Process Specification (SC-01) catalog, MS-06-61; Swagelok Photovoltaic Process Specification (SC-06) catalog, MS-06-64; and Swagelok Special Cleaning and Packaging (SC-11) catalog, MS-06 -63, for details on processes, process controls, and process ver i fi ca tion. 005 to 0. In addition to standard Swagelok tube fittings, a range of FK series medium-pressure fittings, cone and thread fittings, hoses, valves, and pressure gauges that are hydrogen-compatible are available. Swagelok downloads including Swagelok catalogs, technical articles, data sheets, more. 3-piece process/instrumentation, Swagelok® 60 series ball valves are designed for reliability and low maintenance. 017 % (welded) promote reliable, consistent orbital welding. Our Continuous Improvement efforts have allowed Swagelok tube fittings to set the standard for excellence since 1947. Available in Ultra-Torr straights and tees. In the following pages you will find technical and ordering information for Swagelok cone and thread and medium-pressure tube fittings. male pipe end connections Swagelok 1/2 in. It also describes the advanced-geometry, hinging-colleting back ferrule design used to help installers Every Swagelok K series pressure regulator is cleaned and packaged in accordance with Swagelok Standard Cleaning and Packaging (SC-10) catalog, MS-06-62. Swagelok ® NPT pipe fittings provide reliable connections in pipe and tubing systems used in most industrial applications. This catalog provides the technical detail required for alloy medium and high pressure products that are used in high chloride applications. Tubing Selection Proper selection, handling, and installation of tubing, when combined with proper selection of Swagelok® tube fittings, are essential to reliable tubing systems. Rating based on repeated pressure testing of the Swagelok tube fitting with a 4:1 design factor based upon hydraulic fluid leakage. Swagelok tube fittings and tube adapters, available in a variety of materials, are engineered to provide a consistent, leak-tight seal in critical applications. The following languages are fully supported on our offering of international sites, including detailed product information and e-commerce funcitonality. Find reliable tube, pipe, weld, and face seal fittings in a variety of materials and shapes to ensure leak-tight connections in your industrial fluid system. Swagelok Instrumentation Ball Valves Swagelok one-piece instrumentation ball valves have been well accepted and widely used in a variety of industries for many years. and 6 to 25 mm Swagelok stainless steel tube fittings to help installers make more consistent, leak-tight tube connections. This catalog covers several of our products suitable for applications requiring higher pressures. Note: For these applications, regional standards and specifications may vary. Hose, 340 Dimensions, in inches (millimeters), are for reference only and are subject to change. End connections include Swagelok® tube fittings, NPT, and male VCR® face seal fittings. Due to the brass bonnet threads, cycle life of brass valves may be reduced when operated frequently at pressures above 450 psig (31. Features Swagelok Company has qualified the Swagelok® alloy 400 fitting product line in sizes from 1/8 to 1/2 in. pipe and 1/4 to 1 in. Every 60 series ball valve is cleaned in accordance with Swagelok Standard Cleaning and Packaging (SC-10) catalog, MS-06-62. This design is standard on all 1/4 to 1 in. Brass valves only available with manual or 1 series pneumatic actuators. Raw Materials Swagelok UHP and chemically cleaned tubular fittings are manufactured from 316L stainless steel; controlled sulfur levels of 0. We are a stocking distributor of Swagelok tube fittings and recently supplied in Saudi Arabia, UAE, Canada, Australia, Malaysia, and the Philippines. Swagelok® Medium-Pressure Gaugeable Tube Fittings and Adapter Fittings For Pressures up to 20 000 psig (1378 bar) 1 Simple two-piece construction, color-coded ferrules Download Swagelok fitting catalogs for specifications, features, ordering information, and more. These easy-to-use tube benders reduce installation time and effort as well as the potential for wrinkling or other damage to the tubing during bending. Install the fitting. com the source for tube fittings, valves, and other Installation Instructions Insert the gauge with integral Swagelok tube adapter into a Swagelok tube fitting. pdf - Free download as PDF File (. We are pleased to provide this global edition of the An Installer’s Pocket Guide for Swagelok Tube Fittings. This design separates the sealing and tube gripping functions between two ferrules for optimized performance. The designs of Swagelok gas distribution systems make it easy to ensure you’re getting the most usage of the gas in your supply bottles. In addition, our Download Swagelok valves catalogs PDF. Navy approval for use on surface ships (see table footnote , below). Nonvolatile residue levels are compliant with ASTM G93, Level A requirements. Cleaning and Packaging All Swagelok flange adapters are cleaned in accordance with Swagelok Standard Cleaning and Packaging (SC-10) catalog, MS-06-62. These fittings have been used successfully on demanding applications in such fields as semiconductor, alternative fuels, chemical and petrochemical, oil and gas, fossil and nuclear power, pulp and paper, and aerospace. For more information about pressure ratings of valves with tube fitting end connections, refer to Swagelok® Tubing Data catalog, MS-01-107. This document provides information for ordering Swagelok tube fittings and adapter fittings, including: 1) The sequence of the ordering number and what each segment represents such as material, size, fitting type, end connections, etc. Identify Thread Pitch and Size These fittings are available in a range of shapes and materials, as Swagelok® Medium- and High-Pressure Fittings, Valves, and Tubing Since 1947, Swagelok has designed, developed, and manufactured high-quality fluid system products to meet the evolving needs of global industries. Swagelok vacuum fittings ensure repeatable results. (P6T series) valves with Swagelok tube fitting, female pipe, and up to 3/8 in. A. pdf), Text File (. Swagelok ultra-torr vacuum fittings are cleaned to remove machine oil, grease, and loose particles. Stainless steel construction, fluorocarbon FKM O-ring Reliable, repeatable sealing performance O-ring seals to glass, metal, or plastic tubing Knurled nut for easy, finger TS Series Biopharm Fittings Swagelok® TS series biopharm fittings are designed to solve problems inherent in conventional sanitary clamp fittings: gasket extrusion and the resulting fluid holdup. 0 bar). Gaugeable Tube Fittings and Adapter Fittings (MS-01-140;rev_AE;en-US;Catalog) - Free download as PDF File (. Headquartered in Solon, Ohio, U. As with any mixed-material assembly, pressure ratings for tubing and fittings from different alloys will be governed by the lower material rating. Designed for use with saturated steam systems, the Swagelok TVA series integrated test valve assembly consists of two 60 series ball valves and a universal mount in one integrated package. High-flow Swagelok® “H” Type VCR® fittings, Swagelok VCR fittings, and tube butt weld end connections are available. Swagelok DL and DS series valves are processed in accordance with Swagelok Special Cleaning and Packaging (SC-11) catalog, MS-06-63, to ensure compliance with product cleanliness requirements stated in ASTM G93 Level C. Contact your authorized Swagelok representative or see these Swagelok catalogs for more information: Swagelok Gaugeable Alloy 2507 Super Duplex Tube Fittings catalog, MS-01-174 The flow through a Swagelok manifold is controlled by a series of stainless steel needle valves. For alloy 400 tube fittings, see the Swagelok Gaugeable Alloy 400/R-405 Mechanically Attached Pipe and Tube Fittings catalog, MS-0 - . , Swagelok serves customers through 200 sales and service centers in 70 countries, supported by the expertise of 5,500 Swagelok can provide factory assemblies with pneumatic actuators, solenoid valves, limit switches, and position sensors, as well as kits for field assembly. If more specific information, including heat code traceability, is required Tubefit Engineers will provide details. Swagelok has conducted tests in accordance with ASTM B117-95 to evaluate the corrosion resistance The following languages are fully supported on our offering of international sites, including detailed product information and e-commerce funcitonality. All of these systems are highly configurable, and components within the systems can be easily removed or replaced for maintenance due to flexible mounting solutions and the use of Swagelok tube fittings. (P4T series) plug valves with Swagelok tube fitting, female pipe, and up to 1/8 in. Swagelok 1/4 in. Chemically cleaned and passivated tubular fittings are manufactured from 316L stainless steel. All other C, CA, and CH series check valves, as well as every CP and CPA series check valve, are cleaned in accordance with Swagelok Standard Cleaning and Packaging (SC-10), Cleaning and Packaging Swagelok metering valves with VCR end connections are processed in accordance with Swagelok Special Cleaning and Packaging (SC-11) catalog, MS-06-63, to ensure compliance with product cleanliness requirements stated in ASTM G93 Level C. These products have the following pressure characteristics: Get Swagelok product catalogs, quick look brochures, manuals and handbooks available online. For 5/8, 3/4, 7/8, and 1 in (16, 18, 20, 22, and 25mm) tube fittings in all materials except for aluminum and brass, it is a best practice to preswage the ferrules onto the tube using a Swagelok multihead hydraulic swaging unit (MHSU) to lower installation For higher pressures, see the Swagelok Medium- and High-Pressure Fittings, Tubing, Valves and Accessories catalog, MS-02-472. Medium and High Pressure Fittings Tubing Valves and Accessories including IPT, Cone, Thread, FK, FKB and Sno-Trik (MS-02-472-FITTINGS;rev_D;en-US;Catalog) Heavy-wall fittings are available only in 316 stainless steel. Swagelok has conducted tests in accordance with ASTM B117-95 to evaluate the corrosion resistance For more information about pressure ratings of valves with tube fitting end connections, see Swagelok Tubing Data, MS-01-107. txt) or read online for free. Swagelok metering valves with other end connections are processed in accordance with Swagelok Standard Cleaning and Packaging (SC-10 Tubefit Engineers tube fitting has also found special application in other fields where high pressure tube fitting has also found special application in other fields where high pressure tube fittings are required. hpobalobmgiczsfxgfbjrtkcenttmnpnpqrdaqqgckehqrcfneuiaagqzkxpaytejjygaaccslbvbp